PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 309aa    MW: 34673.9 Da    PI: 5.1951
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1400genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding65.59.9e-211663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+++++ +G g+Wkt +++ g++R++k+c++rw +yl
      Gh_A08G1400 16 KGPWTPEEDEKLLEYINTHGHGNWKTLPKHAGLNRCGKSCRLRWANYL 63
                     79********************************************97 PP

2Myb_DNA-binding52.51.1e-1669113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr ++eE+ l+++++  lG++ W++Ia +++ gRt++++k++w+++
      Gh_A08G1400  69 RGRLSEEEERLIINLHSTLGNK-WSKIATYLP-GRTDNEIKNFWNTH 113
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.2281163IPR017930Myb domain
SMARTSM007174.6E-171565IPR001005SANT/Myb domain
SuperFamilySSF466898.63E-3215110IPR009057Homeodomain-like
PfamPF002498.6E-191663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-251770IPR009057Homeodomain-like
CDDcd001672.58E-131863No hitNo description
PROSITE profilePS5129426.86864118IPR017930Myb domain
SMARTSM007171.1E-1568116IPR001005SANT/Myb domain
PfamPF002493.6E-1569113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-2571118IPR009057Homeodomain-like
CDDcd001676.12E-1273114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRSPCCSSD DAILKKGPWT PEEDEKLLEY INTHGHGNWK TLPKHAGLNR CGKSCRLRWA  60
NYLRPDIKRG RLSEEEERLI INLHSTLGNK WSKIATYLPG RTDNEIKNFW NTHIRKKLLN  120
MGLDPNTHKP RTDLNHLLNL TQLICAAQLG SLMNPWDSSA LKVQADAAQL LQNLIQTLNT  180
NQLSTITAGL MGSQNSYPYE GLINGTSSLY ADEPAPVPQK FHSISQGVID NSWASFEGYE  240
IPDMSDFLIS ELVSESPETA TTSMNQMGDD KTNTNHSSTM SPADTSMFQA WEKLMGDETD  300
SSFWEDILE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31141185108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477974.10.0PREDICTED: transcription factor MYB39
TrEMBLA0A0D2PEA10.0A0A0D2PEA1_G
STRINGPOPTR_0003s09300.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-80myb domain protein 9